SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4bvma1 (4bvm A:0-131)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2062521Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2062522Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2063049Family b.60.1.2: Fatty acid binding protein-like [50847] (18 protein domains)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2063324Protein automated matches [190295] (6 species)
    not a true protein
  7. 2063340Species Human (Homo sapiens) [TaxId:9606] [187133] (54 PDB entries)
  8. 2063341Domain d4bvma1: 4bvm A:0-131 [235978]
    Other proteins in same PDB: d4bvma2
    automated match to d2wuta_
    complexed with cit, plm, vca

Details for d4bvma1

PDB Entry: 4bvm (more details), 0.93 Å

PDB Description: The peripheral membrane protein P2 from human myelin at atomic resolution
PDB Compounds: (A:) myelin p2 protein

SCOPe Domain Sequences for d4bvma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bvma1 b.60.1.2 (A:0-131) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msnkflgtwklvssenfddymkalgvglatrklgnlakptviiskkgdiitirtestfkn
teisfklgqefeettadnrktksivtlqrgslnqvqrwdgkettikrklvngkmvaeckm
kgvvctriyekv

SCOPe Domain Coordinates for d4bvma1:

Click to download the PDB-style file with coordinates for d4bvma1.
(The format of our PDB-style files is described here.)

Timeline for d4bvma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bvma2