Lineage for d4blla_ (4bll A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2720706Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2720707Protein automated matches [191104] (14 species)
    not a true protein
  7. 2720828Species Oyster mushroom (Pleurotus ostreatus) [TaxId:5322] [235966] (11 PDB entries)
  8. 2720830Domain d4blla_: 4bll A: [235974]
    automated match to d4fcna_
    complexed with ca, hem, zn

Details for d4blla_

PDB Entry: 4bll (more details), 1.1 Å

PDB Description: crystal structure of fungal versatile peroxidase i from pleurotus ostreatus - crystal form ii
PDB Compounds: (A:) versatile peroxidase I

SCOPe Domain Sequences for d4blla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4blla_ a.93.1.0 (A:) automated matches {Oyster mushroom (Pleurotus ostreatus) [TaxId: 5322]}
atcadgrttanaaccvlfpilddiqenlfdgaqcgeevheslrltfhdaigfsptlgggg
adgsiitfdtietnfpanagideivsaqkpfvakhnisagdfiqfagavgvsncpggvri
pfflgrpdavaaspdhlvpepfdsvdtilarmgdagfsavevvwllashsiaaadkvdps
ipgtpfdstpgvfdsqffietqlkgrlfpgtpdnkgevqsplqgeirlqsdhllardpqt
acewqsmvnnqpkiqnrfagtmskmallgqdksklidcsdiiptppalvgaahlpagfsl
sdveqacaetpfpaltad

SCOPe Domain Coordinates for d4blla_:

Click to download the PDB-style file with coordinates for d4blla_.
(The format of our PDB-style files is described here.)

Timeline for d4blla_: