Lineage for d4blza_ (4blz A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2720706Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2720707Protein automated matches [191104] (14 species)
    not a true protein
  7. 2720828Species Oyster mushroom (Pleurotus ostreatus) [TaxId:5322] [235966] (11 PDB entries)
  8. 2720838Domain d4blza_: 4blz A: [235973]
    automated match to d2vkaa_
    complexed with ca, hem

Details for d4blza_

PDB Entry: 4blz (more details), 2 Å

PDB Description: crystal structure of fungal versatile peroxidase i from pleurotus ostreatus - crystal form vi
PDB Compounds: (A:) versatile peroxidase I

SCOPe Domain Sequences for d4blza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4blza_ a.93.1.0 (A:) automated matches {Oyster mushroom (Pleurotus ostreatus) [TaxId: 5322]}
atcadgrttanaaccvlfpilddiqenlfdgaqcgeevheslrltfhdaigfsptlgggg
adgsiitfdtietnfpanagideivsaqkpfvakhnisagdfiqfagavgvsncpggvri
pfflgrpdavaaspdhlvpepfdsvdtilarmgdagfsavevvwllashsiaaadkvdps
ipgtpfdstpgvfdsqffietqlkgrlfpgtpdnkgevqsplqgeirlqsdhllardpqt
acewqsmvnnqpkiqnrfagtmskmallgqdksklidcsdiiptppalvgaahlpagfsl
sdveqacaetpfpaltadpgpvtsvppvp

SCOPe Domain Coordinates for d4blza_:

Click to download the PDB-style file with coordinates for d4blza_.
(The format of our PDB-style files is described here.)

Timeline for d4blza_: