Lineage for d4bm1a_ (4bm1 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1496989Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1496990Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 1497575Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 1497576Protein automated matches [191104] (9 species)
    not a true protein
  7. 1497627Species Oyster mushroom (Pleurotus ostreatus) [TaxId:5322] [235966] (11 PDB entries)
  8. 1497630Domain d4bm1a_: 4bm1 A: [235967]
    automated match to d3q3ua_
    complexed with ca, cit, hem, so4

Details for d4bm1a_

PDB Entry: 4bm1 (more details), 1.1 Å

PDB Description: crystal structure of manganese peroxidase 4 from pleurotus ostreatus - crystal form i
PDB Compounds: (A:) manganese peroxidase 4

SCOPe Domain Sequences for d4bm1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bm1a_ a.93.1.0 (A:) automated matches {Oyster mushroom (Pleurotus ostreatus) [TaxId: 5322]}
akcskgrtasndaccvwfdvlddiqenlfdggecgeevheslrltfhdaigfspaltrqg
kfggggadgsimlfsdietnfaanngvddiveqqkpiaikhqvsfgdfiqfagavgssnc
aggpriqflagrsnvtkpspdhlvpepfdsvtsilarmgdagfkpdevvallashsvaaq
dtidpklaghpfdstpsdfdsqffvetllkgtlipgdslhkgqvksplpgefrlqsdell
ardsrtscewqsfisnpnsmvpkferamakmatlgqnpkklidcsevipvprgrvkqptl
pagktikdieascrkapfprlptdkgtftsilpvpss

SCOPe Domain Coordinates for d4bm1a_:

Click to download the PDB-style file with coordinates for d4bm1a_.
(The format of our PDB-style files is described here.)

Timeline for d4bm1a_: