SCOPe 2.08: Domain d4bm1a_: 4bm1 A:

Lineage for d4bm1a_ (4bm1 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.0: automated matches [191605] (1 protein)
   not a true family

6. Protein automated matches [191104] (14 species)
   not a true protein

7. Species Oyster mushroom (Pleurotus ostreatus) [TaxId:5322] [235966] (11 PDB entries)

8. Domain d4bm1a_: 4bm1 A: [235967]
   automated match to d3q3ua_
   complexed with ca, cit, hem, so4

Details for d4bm1a_

PDB Entry: 4bm1, 1.1 Å

PDB Description: crystal structure of manganese peroxidase 4 from pleurotus ostreatus - crystal form i

PDB Compounds: (A:) manganese peroxidase 4

SCOPe Domain Sequences for d4bm1a_:

Sequence; same for both SEQRES and ATOM records:

>d4bm1a_ a.93.1.0 (A:) automated matches {Oyster mushroom (Pleurotus ostreatus) [TaxId: 5322]}
akcskgrtasndaccvwfdvlddiqenlfdggecgeevheslrltfhdaigfspaltrqg
kfggggadgsimlfsdietnfaanngvddiveqqkpiaikhqvsfgdfiqfagavgssnc
aggpriqflagrsnvtkpspdhlvpepfdsvtsilarmgdagfkpdevvallashsvaaq
dtidpklaghpfdstpsdfdsqffvetllkgtlipgdslhkgqvksplpgefrlqsdell
ardsrtscewqsfisnpnsmvpkferamakmatlgqnpkklidcsevipvprgrvkqptl
pagktikdieascrkapfprlptdkgtftsilpvpss

Timeline for d4bm1a_:

• d4bm1a_ first appeared in SCOPe 2.03
  
• d4bm1a_ appears in SCOPe 2.07