SCOPe 2.08: Domain d3k74b_: 3k74 B:

Lineage for d3k74b_ (3k74 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d3k74b_: 3k74 B: [235964]
   Other proteins in same PDB: d3k74a_
   automated match to d1t2ja_

Details for d3k74b_

PDB Entry: 3k74, 1.95 Å

PDB Description: disruption of protein dynamics by an allosteric effector antibody

PDB Compounds: (B:) Nanobody

SCOPe Domain Sequences for d3k74b_:

Sequence; same for both SEQRES and ATOM records:

>d3k74b_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qlqesggglvqpggslrlscaasgftfnnywmywvrrapgkglewvsminpggiitkyae
svkgrftisrdnakntlylqmnsltsedtavyycakdwatglakkgqgtqvtvss

Timeline for d3k74b_:

• d3k74b_ first appeared in SCOPe 2.03
  
• d3k74b_ appears in SCOPe 2.07