SCOPe 2.03: Domain d2uv7a_: 2uv7 A:

Lineage for d2uv7a_ (2uv7 A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.0: automated matches [191603] (1 protein)
   not a true family

6. Protein automated matches [191100] (10 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [231280] (4 PDB entries)

8. Domain d2uv7a_: 2uv7 A: [235963]
   automated match to d2nyca1
   complexed with amp

Details for d2uv7a_

PDB Entry: 2uv7, 2 Å

PDB Description: crystal structure of a cbs domain pair from the regulatory gamma1 subunit of human ampk in complex with amp

PDB Compounds: (A:) 5'-amp-activated protein kinase subunit gamma-1

SCOPe Domain Sequences for d2uv7a_:

Sequence; same for both SEQRES and ATOM records:

>d2uv7a_ d.37.1.0 (A:) automated matches {Homo sapiens [TaxId: 9606]}
hefpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekgrvvdi
yskfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetletiinrlveaevhgl
vvvdendvvkgivslsdilqalvl

Timeline for d2uv7a_:

• d2uv7a_ is new in SCOPe 2.03-stable
  
• d2uv7a_ appears in SCOPe 2.04
  
• d2uv7a_ appears in the current release, SCOPe 2.08, called d2uv7a1