SCOPe 2.08: Domain d4cdgc1: 4cdg C:23-140

Lineage for d4cdgc1 (4cdg C:23-140)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d4cdgc1: 4cdg C:23-140 [235932]
   Other proteins in same PDB: d4cdgc2, d4cdgd2
   automated match to d4cdgd_
   complexed with adp, zn

Details for d4cdgc1

PDB Entry: 4cdg, 2.79 Å

PDB Description: crystal structure of the bloom's syndrome helicase blm in complex with nanobody

PDB Compounds: (C:) Nanobody

SCOPe Domain Sequences for d4cdgc1:

Sequence; same for both SEQRES and ATOM records:

>d4cdgc1 b.1.1.1 (C:23-140) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqaggslrlscaasgiwfsinnmawyrqtpgkqreriaiitsagttnyv
dsvkgrftisrddakntmylqmnslipedtavyycnlvadydmgfqsfwgrgtqvtvs

Timeline for d4cdgc1:

• d4cdgc1 first appeared in SCOPe 2.03, called d4cdgc_
  
• d4cdgc1 appears in SCOPe 2.07