Lineage for d1gcsa2 (1gcs A:86-174)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2045692Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2045693Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2045694Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)
  6. 2045732Protein gamma-Crystallin [49697] (9 species)
    duplication consists of two domains of this fold
  7. 2045739Species Cow (Bos taurus), isoform II (B) [TaxId:9913] [49698] (6 PDB entries)
  8. 2045746Domain d1gcsa2: 1gcs A:86-174 [23593]

Details for d1gcsa2

PDB Entry: 1gcs (more details), 2 Å

PDB Description: structure of the bovine gamma-b crystallin at 150k
PDB Compounds: (A:) gamma-b crystallin

SCOPe Domain Sequences for d1gcsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gcsa2 b.11.1.1 (A:86-174) gamma-Crystallin {Cow (Bos taurus), isoform II (B) [TaxId: 9913]}
gtfrmriyerddfrgqmseitddcpslqdrfhltevhslnvlegswvlyempsyrgrqyl
lrpgeyrryldwgamnakvgslrrvmdfy

SCOPe Domain Coordinates for d1gcsa2:

Click to download the PDB-style file with coordinates for d1gcsa2.
(The format of our PDB-style files is described here.)

Timeline for d1gcsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gcsa1