Lineage for d3zhda1 (3zhd A:1-118)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2024002Species Human (Homo sapiens) [TaxId:9606] [188740] (183 PDB entries)
  8. 2024082Domain d3zhda1: 3zhd A:1-118 [235925]
    Other proteins in same PDB: d3zhda2, d3zhdb2
    automated match to d1vhpa_
    complexed with so4

Details for d3zhda1

PDB Entry: 3zhd (more details), 1.96 Å

PDB Description: The crystal structure of single domain antibody 8-4 scaffold.
PDB Compounds: (A:) mg8-4 scaffold antibody

SCOPe Domain Sequences for d3zhda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zhda1 b.1.1.1 (A:1-118) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgftfssyamgwvrqapgkgpevvslisgsggstwy
ddsvkgrftisrdnskntlylqmnslraedtavyycarhapsteapdywgqgtlvtvs

SCOPe Domain Coordinates for d3zhda1:

Click to download the PDB-style file with coordinates for d3zhda1.
(The format of our PDB-style files is described here.)

Timeline for d3zhda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3zhda2