Lineage for d3zhda_ (3zhd A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757949Protein automated matches [190119] (18 species)
    not a true protein
  7. 1758005Species Human (Homo sapiens) [TaxId:9606] [188740] (120 PDB entries)
  8. 1758078Domain d3zhda_: 3zhd A: [235925]
    automated match to d1vhpa_
    complexed with so4

Details for d3zhda_

PDB Entry: 3zhd (more details), 1.96 Å

PDB Description: The crystal structure of single domain antibody 8-4 scaffold.
PDB Compounds: (A:) mg8-4 scaffold antibody

SCOPe Domain Sequences for d3zhda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zhda_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgftfssyamgwvrqapgkgpevvslisgsggstwy
ddsvkgrftisrdnskntlylqmnslraedtavyycarhapsteapdywgqgtlvtvssl

SCOPe Domain Coordinates for d3zhda_:

Click to download the PDB-style file with coordinates for d3zhda_.
(The format of our PDB-style files is described here.)

Timeline for d3zhda_: