Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (18 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (120 PDB entries) |
Domain d3zhda_: 3zhd A: [235925] automated match to d1vhpa_ complexed with so4 |
PDB Entry: 3zhd (more details), 1.96 Å
SCOPe Domain Sequences for d3zhda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zhda_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} evqlvesggglvqpggslrlscaasgftfssyamgwvrqapgkgpevvslisgsggstwy ddsvkgrftisrdnskntlylqmnslraedtavyycarhapsteapdywgqgtlvtvssl
Timeline for d3zhda_: