SCOPe 2.08: Domain d3zhka1: 3zhk A:1-118

Lineage for d3zhka1 (3zhk A:1-118)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d3zhka1: 3zhk A:1-118 [235922]
   Other proteins in same PDB: d3zhka2, d3zhkb2
   automated match to d1vhpa_
   complexed with so4

Details for d3zhka1

PDB Entry: 3zhk, 1.96 Å

PDB Description: The crystal structure of single domain antibody 2x1 scaffold

PDB Compounds: (A:) mg2x1 scaffold antibody

SCOPe Domain Sequences for d3zhka1:

Sequence; same for both SEQRES and ATOM records:

>d3zhka1 b.1.1.1 (A:1-118) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgftfssyamswvrqapgkglewvsaisgsggstyy
adsvkgrftisrdnsknllylqmnslraedtavyycarhapsteapdywgqgtlvtvs

Timeline for d3zhka1:

• d3zhka1 first appeared in SCOPe 2.03, called d3zhka_
  
• d3zhka1 appears in SCOPe 2.07