SCOP 1.67: Domain d1gcs_1: 1gcs 1-85

Lineage for d1gcs_1 (1gcs 1-85)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (6 families)

5. Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (4 proteins)

6. Protein gamma-Crystallin [49697] (7 species)
   duplication consists of two domains of this fold

7. Species Cow (Bos taurus), isoform II (B) [TaxId:9913] [49698] (6 PDB entries)

8. Domain d1gcs_1: 1gcs 1-85 [23592]

Details for d1gcs_1

PDB Entry: 1gcs, 2 Å

PDB Description: structure of the bovine gamma-b crystallin at 150k

SCOP Domain Sequences for d1gcs_1:

Sequence; same for both SEQRES and ATOM records:

>d1gcs_1 b.11.1.1 (1-85) gamma-Crystallin {Cow (Bos taurus), isoform II (B)}
gkitfyedrgfqghcyecssdcpnlqpyfsrcnsirvdsgcwmlyerpnyqghqyflrrg
dypdyqqwmgfndsirscrlipqht

Timeline for d1gcs_1:

• d1gcs_1 first appeared (with stable ids) in SCOP 1.55
  
• d1gcs_1 appears in SCOP 1.65
  
• d1gcs_1 appears in SCOP 1.69
  
• d1gcs_1 appears in the current release, SCOPe 2.08, called d1gcsa1