Lineage for d3zkaa_ (3zka A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1389887Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 1389986Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 1389994Family c.92.2.2: TroA-like [53811] (6 proteins)
  6. 1390021Protein automated matches [191053] (3 species)
    not a true protein
  7. 1390022Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [189842] (5 PDB entries)
  8. 1390025Domain d3zkaa_: 3zka A: [235912]
    automated match to d3zk9a_
    complexed with mn, trs

Details for d3zkaa_

PDB Entry: 3zka (more details), 1.55 Å

PDB Description: crystal structure of pneumococcal surface antigen psaa d280n in the metal-bound, open state
PDB Compounds: (A:) manganese abc transporter substrate-binding lipoprotein

SCOPe Domain Sequences for d3zkaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zkaa_ c.92.2.2 (A:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
klkvvatnsiiaditkniagdkidlhsivpigqdpheyeplpedvkktseadlifyngin
letggnawftklvenakktenkdyfavsdgvdviylegqnekgkedphawlnlengiifa
kniakqlsakdpnnkefyeknlkeytdkldkldkeskdkfnkipaekklivtsegafkyf
skaygvpsayiweinteeegtpeqiktlveklrqtkvpslfvessvddrpmktvsqdtni
piyaqiftnsiaeqgkegdsyysmmkynldkiaeglak

SCOPe Domain Coordinates for d3zkaa_:

Click to download the PDB-style file with coordinates for d3zkaa_.
(The format of our PDB-style files is described here.)

Timeline for d3zkaa_: