Lineage for d3zk7b_ (3zk7 B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1624120Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 1624224Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 1624232Family c.92.2.2: TroA-like [53811] (6 proteins)
  6. 1624259Protein automated matches [191053] (3 species)
    not a true protein
  7. 1624260Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [189842] (6 PDB entries)
  8. 1624268Domain d3zk7b_: 3zk7 B: [235910]
    automated match to d3zk7a_
    complexed with trs

Details for d3zk7b_

PDB Entry: 3zk7 (more details), 1.69 Å

PDB Description: crystal structure of pneumococcal surface antigen psaa in the metal- free, open state
PDB Compounds: (B:) manganese abc transporter substrate-binding lipoprotein

SCOPe Domain Sequences for d3zk7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zk7b_ c.92.2.2 (B:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
klkvvatnsiiaditkniagdkidlhsivpigqdpheyeplpedvkktseadlifyngin
letggnawftklvenakktenkdyfavsdgvdviylegqnekgkedphawlnlengiifa
kniakqlsakdpnnkefyeknlkeytdkldkldkeskdkfnkipaekklivtsegafkyf
skaygvpsayiweinteeegtpeqiktlveklrqtkvpslfvessvddrpmktvsqdtni
piyaqiftdsiaeqgkegdsyysmmkynldkiaeglak

SCOPe Domain Coordinates for d3zk7b_:

Click to download the PDB-style file with coordinates for d3zk7b_.
(The format of our PDB-style files is described here.)

Timeline for d3zk7b_: