| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) ![]() contains a long alpha helical insertion in the interdomain linker |
| Family c.92.2.2: TroA-like [53811] (6 proteins) |
| Protein automated matches [191053] (3 species) not a true protein |
| Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [189842] (5 PDB entries) |
| Domain d3zk7b_: 3zk7 B: [235910] automated match to d3zk7a_ complexed with trs |
PDB Entry: 3zk7 (more details), 1.69 Å
SCOPe Domain Sequences for d3zk7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zk7b_ c.92.2.2 (B:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
klkvvatnsiiaditkniagdkidlhsivpigqdpheyeplpedvkktseadlifyngin
letggnawftklvenakktenkdyfavsdgvdviylegqnekgkedphawlnlengiifa
kniakqlsakdpnnkefyeknlkeytdkldkldkeskdkfnkipaekklivtsegafkyf
skaygvpsayiweinteeegtpeqiktlveklrqtkvpslfvessvddrpmktvsqdtni
piyaqiftdsiaeqgkegdsyysmmkynldkiaeglak
Timeline for d3zk7b_: