Lineage for d3zc3b2 (3zc3 B:142-303)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1589855Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 1589856Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 1589857Family c.25.1.1: Reductases [52344] (5 proteins)
  6. 1589941Protein automated matches [226995] (7 species)
    not a true protein
  7. 1589956Species Nostoc sp. [TaxId:1168] [229177] (3 PDB entries)
  8. 1589960Domain d3zc3b2: 3zc3 B:142-303 [235908]
    Other proteins in same PDB: d3zc3a1, d3zc3b1
    automated match to d3zc3a2
    complexed with fad, gol, nap; mutant

Details for d3zc3b2

PDB Entry: 3zc3 (more details), 2.3 Å

PDB Description: ferredoxin-nadp reductase (mutation s80a) complexed with nadp by cocrystallization
PDB Compounds: (B:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d3zc3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zc3b2 c.25.1.1 (B:142-303) automated matches {Nostoc sp. [TaxId: 1168]}
lpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily
keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadelwqliknekthtyic
glrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety

SCOPe Domain Coordinates for d3zc3b2:

Click to download the PDB-style file with coordinates for d3zc3b2.
(The format of our PDB-style files is described here.)

Timeline for d3zc3b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3zc3b1