SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3zc3b2 (3zc3 B:142-303)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105127Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2105128Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2105129Family c.25.1.1: Reductases [52344] (5 protein domains)
  6. 2105215Protein automated matches [226995] (7 species)
    not a true protein
  7. 2105230Species Nostoc sp. [TaxId:1168] [229177] (3 PDB entries)
  8. 2105234Domain d3zc3b2: 3zc3 B:142-303 [235908]
    Other proteins in same PDB: d3zc3a1, d3zc3b1
    automated match to d3zc3a2
    complexed with fad, gol, nap; mutant

Details for d3zc3b2

PDB Entry: 3zc3 (more details), 2.3 Å

PDB Description: ferredoxin-nadp reductase (mutation s80a) complexed with nadp by cocrystallization
PDB Compounds: (B:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d3zc3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zc3b2 c.25.1.1 (B:142-303) automated matches {Nostoc sp. [TaxId: 1168]}
lpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily
keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadelwqliknekthtyic
glrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety

SCOPe Domain Coordinates for d3zc3b2:

Click to download the PDB-style file with coordinates for d3zc3b2.
(The format of our PDB-style files is described here.)

Timeline for d3zc3b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3zc3b1