SCOPe 2.07: Domain d4ngal_: 4nga L:

Lineage for d4ngal_ (4nga L:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein automated matches [190092] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187310] (72 PDB entries)

8. Domain d4ngal_: 4nga L: [235901]
   Other proteins in same PDB: d4ngah_
   automated match to d1w7xl_
   complexed with 2kf, ca, gol, so4

Details for d4ngal_

PDB Entry: 4nga, 2.15 Å

PDB Description: factor viia in complex with the inhibitor (2r)-2-[(1-aminoisoquinolin- 6-yl)amino]-2-[3-ethoxy-4-(propan-2-yloxy)phenyl]-n-[2-(propan-2- ylsulfonyl)benzyl]ethanamide

PDB Compounds: (L:) Factor VIIa (Light Chain)

SCOPe Domain Sequences for d4ngal_:

Sequence; same for both SEQRES and ATOM records:

>d4ngal_ g.3.11.1 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
icvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilekr

Timeline for d4ngal_:

• d4ngal_ first appeared in SCOPe 2.03
  
• d4ngal_ appears in SCOPe 2.06
  
• d4ngal_ appears in the current release, SCOPe 2.08