SCOPe 2.05: Domain d4ng9l_: 4ng9 L:

Lineage for d4ng9l_ (4ng9 L:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Coagulation factor VIIa [57201] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57202] (56 PDB entries)
   Uniprot P08709 108-202 ! Uniprot P08709 107-202

8. Domain d4ng9l_: 4ng9 L: [235900]
   Other proteins in same PDB: d4ng9h_
   automated match to d1w7xl_
   complexed with 2ke, ca, gol, so4

Details for d4ng9l_

PDB Entry: 4ng9, 2.2 Å

PDB Description: factor viia in complex with the inhibitor (2r)-2-[(1-aminoisoquinolin- 6-yl)amino]-2-[3-ethoxy-4-(propan-2-yloxy)phenyl]-n-(3- sulfamoylbenzyl)ethanamide

PDB Compounds: (L:) Factor VIIa (Light Chain)

SCOPe Domain Sequences for d4ng9l_:

Sequence, based on SEQRES records:

>d4ng9l_ g.3.11.1 (L:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
icvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilekr

Sequence, based on observed residues (ATOM records):

>d4ng9l_ g.3.11.1 (L:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
icvnenggceqycsdhtgkrscrchegyslladgvsctptveypcgkipilekr

Timeline for d4ng9l_:

• d4ng9l_ first appeared in SCOPe 2.03
  
• d4ng9l_ appears in SCOPe 2.04
  
• d4ng9l_ appears in SCOPe 2.06
  
• d4ng9l_ appears in the current release, SCOPe 2.08