Lineage for d4gcr_2 (4gcr 86-174)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) Superfamily b.11.1: gamma-Crystallin-like [49695] (5 families) 
Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (4 proteins) Protein gamma-Crystallin [49697] (4 species) Species Cow (Bos taurus), isoform II (B) [TaxId:9913] [49698] (5 PDB entries) 
Domain d4gcr_2: 4gcr 86-174 [23590]
Details for d4gcr_2
PDB Entry: 4gcr (more details), 1.47 Å
PDB Description: structure of the bovine eye lens protein gamma-b (gamma-ii)-crystallin at 1.47 angstroms
SCOP Domain Sequences for d4gcr_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gcr_2 b.11.1.1 (86-174) gamma-Crystallin {Cow (Bos taurus), isoform II (B)}
gtfrmriyerddfrgqmseitddcpslqdrfhltevhslnvlegswvlyempsyrgrqyl
lrpgeyrryldwgamnakvgslrrvmdfy
SCOP Domain Coordinates for d4gcr_2:
Click to download the PDB-style file with coordinates for d4gcr_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4gcr_2:
- d4gcr_2 appears in SCOP 1.57
- d4gcr_2 appears in the current release, SCOPe 2.08, called d4gcra2
View in 3D
