SCOPe 2.06: Domain d4n7fb1: 4n7f B:422-454

Lineage for d4n7fb1 (4n7f B:422-454)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.72: WW domain-like [51044] (3 superfamilies)
   core: 3-stranded meander beta-sheet

4. Superfamily b.72.1: WW domain [51045] (2 families)

5. Family b.72.1.0: automated matches [227264] (1 protein)
   not a true family

6. Protein automated matches [227055] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226058] (14 PDB entries)

8. Domain d4n7fb1: 4n7f B:422-454 [235899]
   Other proteins in same PDB: d4n7fa2, d4n7fb2
   automated match to d2jmfa1

Details for d4n7fb1

PDB Entry: 4n7f, 1.1 Å

PDB Description: Crystal structure of 3rd WW domain of human Nedd4-1

PDB Compounds: (B:) E3 ubiquitin-protein ligase NEDD4

SCOPe Domain Sequences for d4n7fb1:

Sequence; same for both SEQRES and ATOM records:

>d4n7fb1 b.72.1.0 (B:422-454) automated matches {Human (Homo sapiens) [TaxId: 9606]}
flpkgwevrhapngrpffidhntktttwedprl

Timeline for d4n7fb1:

• d4n7fb1 first appeared in SCOPe 2.03, called d4n7fb_
  
• d4n7fb1 was called d4n7fb_ in SCOPe 2.05
  
• d4n7fb1 appears in SCOPe 2.07
  
• d4n7fb1 appears in the current release, SCOPe 2.08