![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.72: WW domain-like [51044] (3 superfamilies) core: 3-stranded meander beta-sheet |
![]() | Superfamily b.72.1: WW domain [51045] (2 families) ![]() |
![]() | Family b.72.1.0: automated matches [227264] (1 protein) not a true family |
![]() | Protein automated matches [227055] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [226058] (17 PDB entries) |
![]() | Domain d4n7fb1: 4n7f B:422-454 [235899] Other proteins in same PDB: d4n7fa2, d4n7fb2 automated match to d2jmfa1 |
PDB Entry: 4n7f (more details), 1.1 Å
SCOPe Domain Sequences for d4n7fb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n7fb1 b.72.1.0 (B:422-454) automated matches {Human (Homo sapiens) [TaxId: 9606]} flpkgwevrhapngrpffidhntktttwedprl
Timeline for d4n7fb1: