Lineage for d4gcr_1 (4gcr 1-85)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 554580Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 554581Superfamily b.11.1: gamma-Crystallin-like [49695] (6 families) (S)
  5. 554582Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (4 proteins)
  6. 554610Protein gamma-Crystallin [49697] (7 species)
    duplication consists of two domains of this fold
  7. 554617Species Cow (Bos taurus), isoform II (B) [TaxId:9913] [49698] (6 PDB entries)
  8. 554620Domain d4gcr_1: 4gcr 1-85 [23589]

Details for d4gcr_1

PDB Entry: 4gcr (more details), 1.47 Å

PDB Description: structure of the bovine eye lens protein gamma-b (gamma-ii)-crystallin at 1.47 angstroms

SCOP Domain Sequences for d4gcr_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gcr_1 b.11.1.1 (1-85) gamma-Crystallin {Cow (Bos taurus), isoform II (B)}
gkitfyedrgfqghcyecssdcpnlqpyfsrcnsirvdsgcwmlyerpnyqghqyflrrg
dypdyqqwmgfndsirscrlipqht

SCOP Domain Coordinates for d4gcr_1:

Click to download the PDB-style file with coordinates for d4gcr_1.
(The format of our PDB-style files is described here.)

Timeline for d4gcr_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4gcr_2