Lineage for d4liwb1 (4liw B:3-91)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955934Superfamily d.58.56: CcmK-like [143414] (2 families) (S)
    contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
  5. 2955935Family d.58.56.1: CcmK-like [143415] (4 proteins)
    Pfam PF00936; BMC domain
  6. 2955969Protein automated matches [191074] (7 species)
    not a true protein
  7. 2955988Species Synechocystis sp. [TaxId:1111708] [235887] (2 PDB entries)
  8. 2955990Domain d4liwb1: 4liw B:3-91 [235889]
    Other proteins in same PDB: d4liwa2, d4liwb2
    automated match to d3cimc_
    complexed with so4; mutant

Details for d4liwb1

PDB Entry: 4liw (more details), 1.6 Å

PDB Description: ccmk1 carboxysome shell protein from synechocystis pcc6803, l11k point mutant
PDB Compounds: (B:) Carbon dioxide-concentrating mechanism protein ccmK homolog 1

SCOPe Domain Sequences for d4liwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4liwb1 d.58.56.1 (B:3-91) automated matches {Synechocystis sp. [TaxId: 1111708]}
iavgmietkgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsevqasvtagie
nirrvnggevlsnhiiarphenleyvlpi

SCOPe Domain Coordinates for d4liwb1:

Click to download the PDB-style file with coordinates for d4liwb1.
(The format of our PDB-style files is described here.)

Timeline for d4liwb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4liwb2