SCOPe 2.08: Domain d4liwb1: 4liw B:3-91

Lineage for d4liwb1 (4liw B:3-91)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.56: CcmK-like [143414] (2 families)
   contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape

5. Family d.58.56.1: CcmK-like [143415] (4 proteins)
   Pfam PF00936; BMC domain

6. Protein automated matches [191074] (7 species)
   not a true protein

7. Species Synechocystis sp. [TaxId:1111708] [235887] (2 PDB entries)

8. Domain d4liwb1: 4liw B:3-91 [235889]
   Other proteins in same PDB: d4liwa2, d4liwb2
   automated match to d3cimc_
   complexed with so4; mutant

Details for d4liwb1

PDB Entry: 4liw, 1.6 Å

PDB Description: ccmk1 carboxysome shell protein from synechocystis pcc6803, l11k point mutant

PDB Compounds: (B:) Carbon dioxide-concentrating mechanism protein ccmK homolog 1

SCOPe Domain Sequences for d4liwb1:

Sequence; same for both SEQRES and ATOM records:

>d4liwb1 d.58.56.1 (B:3-91) automated matches {Synechocystis sp. [TaxId: 1111708]}
iavgmietkgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsevqasvtagie
nirrvnggevlsnhiiarphenleyvlpi

Timeline for d4liwb1:

• d4liwb1 first appeared in SCOPe 2.03, called d4liwb_
  
• d4liwb1 appears in SCOPe 2.07