SCOPe 2.08: Domain d4irnd2: 4irn D:231-381

Lineage for d4irnd2 (4irn D:231-381)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.0: automated matches [227204] (1 protein)
   not a true family

6. Protein automated matches [226935] (30 species)
   not a true protein

7. Species Oscillatoria sp. [TaxId:272129] [229251] (1 PDB entry)

8. Domain d4irnd2: 4irn D:231-381 [235884]
   Other proteins in same PDB: d4irna1, d4irnb1, d4irnc1, d4irnd1, d4irne1, d4irnf1, d4irng1, d4irnh1
   automated match to d4irnf2
   complexed with fad

Details for d4irnd2

PDB Entry: 4irn, 2.8 Å

PDB Description: Crystal Structure of the Prolyl Acyl Carrier Protein Oxidase AnaB

PDB Compounds: (D:) Prolyl-ACP dehydrogenase

SCOPe Domain Sequences for d4irnd2:

Sequence; same for both SEQRES and ATOM records:

>d4irnd2 a.29.3.0 (D:231-381) automated matches {Oscillatoria sp. [TaxId: 272129]}
gtglaifnhsmewergfilaaavgtmerlleqsiryarshkqfgqaigkfqlvanklvem
klrlenakaylykvawmkenkqmalleasmanlyiseawvqscleaieihgaygyltnte
lerelrdaiaskfysgtseiqrvviakflgl

Timeline for d4irnd2:

• d4irnd2 first appeared in SCOPe 2.03
  
• d4irnd2 appears in SCOPe 2.07