Lineage for d4irng2 (4irn G:231-381)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708344Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2708478Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 2708479Protein automated matches [226935] (30 species)
    not a true protein
  7. 2708672Species Oscillatoria sp. [TaxId:272129] [229251] (1 PDB entry)
  8. 2708679Domain d4irng2: 4irn G:231-381 [235880]
    Other proteins in same PDB: d4irna1, d4irnb1, d4irnc1, d4irnd1, d4irne1, d4irnf1, d4irng1, d4irnh1
    automated match to d4irnf2
    complexed with fad

Details for d4irng2

PDB Entry: 4irn (more details), 2.8 Å

PDB Description: Crystal Structure of the Prolyl Acyl Carrier Protein Oxidase AnaB
PDB Compounds: (G:) Prolyl-ACP dehydrogenase

SCOPe Domain Sequences for d4irng2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4irng2 a.29.3.0 (G:231-381) automated matches {Oscillatoria sp. [TaxId: 272129]}
gtglaifnhsmewergfilaaavgtmerlleqsiryarshkqfgqaigkfqlvanklvem
klrlenakaylykvawmkenkqmalleasmanlyiseawvqscleaieihgaygyltnte
lerelrdaiaskfysgtseiqrvviakflgl

SCOPe Domain Coordinates for d4irng2:

Click to download the PDB-style file with coordinates for d4irng2.
(The format of our PDB-style files is described here.)

Timeline for d4irng2: