Lineage for d1amm_1 (1amm 1-85)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) Superfamily b.11.1: gamma-Crystallin-like [49695] (5 families) 
Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (4 proteins) Protein gamma-Crystallin [49697] (4 species) Species Cow (Bos taurus), isoform II (B) [TaxId:9913] [49698] (5 PDB entries) 
Domain d1amm_1: 1amm 1-85 [23587]
Details for d1amm_1
PDB Entry: 1amm (more details), 1.2 Å
PDB Description: 1.2 angstrom structure of gamma-b crystallin at 150k
SCOP Domain Sequences for d1amm_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1amm_1 b.11.1.1 (1-85) gamma-Crystallin {Cow (Bos taurus), isoform II (B)}
gkitfyedrgfqghcyecssdcpnlqpyfsrcnsirvdsgcwmlyerpnyqghqyflrrg
dypdyqqwmgfndsirscrlipqht
SCOP Domain Coordinates for d1amm_1:
Click to download the PDB-style file with coordinates for d1amm_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1amm_1:
- d1amm_1 appears in SCOP 1.57
- d1amm_1 appears in the current release, SCOPe 2.08, called d1amma1
View in 3D
