Lineage for d4hk8a_ (4hk8 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780055Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2780100Protein Xylanase II [49979] (21 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 2780230Species Trichoderma reesei [TaxId:51453] [235862] (5 PDB entries)
  8. 2780231Domain d4hk8a_: 4hk8 A: [235865]
    automated match to d2jica_
    complexed with cit, gol; mutant

Details for d4hk8a_

PDB Entry: 4hk8 (more details), 1.15 Å

PDB Description: crystal structures of mutant endo- -1,4-xylanase ii complexed with substrate (1.15 a) and products (1.6 a)
PDB Compounds: (A:) Endo-1,4-beta-xylanase 2

SCOPe Domain Sequences for d4hk8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hk8a_ b.29.1.11 (A:) Xylanase II {Trichoderma reesei [TaxId: 51453]}
tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvin
fsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq
rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavqgyfs
sgsasitvs

SCOPe Domain Coordinates for d4hk8a_:

Click to download the PDB-style file with coordinates for d4hk8a_.
(The format of our PDB-style files is described here.)

Timeline for d4hk8a_: