![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
![]() | Protein Xylanase II [49979] (21 species) Partial overlap with common fold and the active sites of the other endoglucanases |
![]() | Species Trichoderma reesei [TaxId:51453] [235862] (5 PDB entries) |
![]() | Domain d4hk8a_: 4hk8 A: [235865] automated match to d2jica_ complexed with cit, gol; mutant |
PDB Entry: 4hk8 (more details), 1.15 Å
SCOPe Domain Sequences for d4hk8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hk8a_ b.29.1.11 (A:) Xylanase II {Trichoderma reesei [TaxId: 51453]} tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvin fsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavqgyfs sgsasitvs
Timeline for d4hk8a_: