Lineage for d4hkoa_ (4hko A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1307103Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1307104Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1308405Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 1308450Protein Xylanase II [49979] (18 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 1308546Species Trichoderma reesei [TaxId:51453] [235862] (4 PDB entries)
  8. 1308549Domain d4hkoa_: 4hko A: [235864]
    automated match to d2jica_
    complexed with iod; mutant

Details for d4hkoa_

PDB Entry: 4hko (more details), 1.5 Å

PDB Description: crystal structures of mutant endo-beta-1,4-xylanase ii (e177q) in the apo form
PDB Compounds: (A:) Endo-1,4-beta-xylanase 2

SCOPe Domain Sequences for d4hkoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hkoa_ b.29.1.11 (A:) Xylanase II {Trichoderma reesei [TaxId: 51453]}
tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvin
fsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq
rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavqgyfs
sgsasitvs

SCOPe Domain Coordinates for d4hkoa_:

Click to download the PDB-style file with coordinates for d4hkoa_.
(The format of our PDB-style files is described here.)

Timeline for d4hkoa_: