Lineage for d1dzla_ (1dzl A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430785Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2432198Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) (S)
  5. 2432199Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins)
  6. 2432200Protein Papillomavirus L1 protein [49692] (1 species)
  7. 2432201Species Human papillomavirus type 16 [TaxId:333760] [49693] (1 PDB entry)
  8. 2432202Domain d1dzla_: 1dzl A: [23586]

Details for d1dzla_

PDB Entry: 1dzl (more details), 3.5 Å

PDB Description: l1 protein of human papillomavirus 16
PDB Compounds: (A:) late major capsid protein l1

SCOPe Domain Sequences for d1dzla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dzla_ b.121.6.1 (A:) Papillomavirus L1 protein {Human papillomavirus type 16 [TaxId: 333760]}
kvvstdeyvartniyyhagtsrllavghpyfpikkpnnnkilvpkvsglqyrvfrihlpd
pnkfgfpdtsfynpdtqrlvwacvgvevgrgqplgvgisghpllnklddtenasayaana
gvdnrecismdykqtqlcligckppigehwgkgspctqvavqpgdcpplelintviqdgd
mvdtgfgamdfttlqanksevpldictsickypdyikmvsepygdslffylrreqmfvrh
lfnragtvgenvpddlyikgsgstanlassnyfptpsgsmvtsdaqifnkpywlqraqgh
nngicwgnqlfvtvvdttrstnmslcaaistsettykntnfkeylrhgeeydlqfifqlc
kitltadvmtyihsmnstiledwnfglqpppggtledtyrfvtsqaiacqkhtppapked
plkkytfwevnlkekfsadldqfplgrkfllqlgl

SCOPe Domain Coordinates for d1dzla_:

Click to download the PDB-style file with coordinates for d1dzla_.
(The format of our PDB-style files is described here.)

Timeline for d1dzla_: