SCOPe 2.06: Domain d1dzla_: 1dzl A:

Lineage for d1dzla_ (1dzl A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families)

5. Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins)

6. Protein Papillomavirus L1 protein [49692] (1 species)

7. Species Human papillomavirus type 16 [TaxId:333760] [49693] (1 PDB entry)

8. Domain d1dzla_: 1dzl A: [23586]

Details for d1dzla_

PDB Entry: 1dzl, 3.5 Å

PDB Description: l1 protein of human papillomavirus 16

PDB Compounds: (A:) late major capsid protein l1

SCOPe Domain Sequences for d1dzla_:

Sequence; same for both SEQRES and ATOM records:

>d1dzla_ b.121.6.1 (A:) Papillomavirus L1 protein {Human papillomavirus type 16 [TaxId: 333760]}
kvvstdeyvartniyyhagtsrllavghpyfpikkpnnnkilvpkvsglqyrvfrihlpd
pnkfgfpdtsfynpdtqrlvwacvgvevgrgqplgvgisghpllnklddtenasayaana
gvdnrecismdykqtqlcligckppigehwgkgspctqvavqpgdcpplelintviqdgd
mvdtgfgamdfttlqanksevpldictsickypdyikmvsepygdslffylrreqmfvrh
lfnragtvgenvpddlyikgsgstanlassnyfptpsgsmvtsdaqifnkpywlqraqgh
nngicwgnqlfvtvvdttrstnmslcaaistsettykntnfkeylrhgeeydlqfifqlc
kitltadvmtyihsmnstiledwnfglqpppggtledtyrfvtsqaiacqkhtppapked
plkkytfwevnlkekfsadldqfplgrkfllqlgl

Timeline for d1dzla_:

• d1dzla_ first appeared (with stable ids) in SCOP 1.55
  
• d1dzla_ appears in SCOPe 2.05
  
• d1dzla_ appears in SCOPe 2.07
  
• d1dzla_ appears in the current release, SCOPe 2.08