Class b: All beta proteins [48724] (110 folds) |
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) |
Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) |
Family b.10.1.4: Animal virus proteins [49656] (16 proteins) |
Protein L1 protein [49692] (1 species) |
Species Human papillomavirus type 16 [TaxId:333760] [49693] (1 PDB entry) |
Domain d1dzla_: 1dzl A: [23586] |
PDB Entry: 1dzl (more details), 3.5 Å
SCOP Domain Sequences for d1dzla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dzla_ b.10.1.4 (A:) L1 protein {Human papillomavirus type 16} kvvstdeyvartniyyhagtsrllavghpyfpikkpnnnkilvpkvsglqyrvfrihlpd pnkfgfpdtsfynpdtqrlvwacvgvevgrgqplgvgisghpllnklddtenasayaana gvdnrecismdykqtqlcligckppigehwgkgspctqvavqpgdcpplelintviqdgd mvdtgfgamdfttlqanksevpldictsickypdyikmvsepygdslffylrreqmfvrh lfnragtvgenvpddlyikgsgstanlassnyfptpsgsmvtsdaqifnkpywlqraqgh nngicwgnqlfvtvvdttrstnmslcaaistsettykntnfkeylrhgeeydlqfifqlc kitltadvmtyihsmnstiledwnfglqpppggtledtyrfvtsqaiacqkhtppapked plkkytfwevnlkekfsadldqfplgrkfllqlgl
Timeline for d1dzla_: