Lineage for d4c4da_ (4c4d A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1532832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1532833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1534111Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
    contains many insertions in the common fold
    automatically mapped to Pfam PF00840
  6. 1534112Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (6 species)
  7. 1534141Species Trichoderma reesei, Cel7A [TaxId:51453] [68898] (13 PDB entries)
  8. 1534142Domain d4c4da_: 4c4d A: [235859]
    automated match to d7cela_
    complexed with co, nag, peg; mutant

Details for d4c4da_

PDB Entry: 4c4d (more details), 1.32 Å

PDB Description: covalent glycosyl-enzyme intermediate of hypocrea jecorina cel7a e217q mutant trapped using dnp-2-deoxy-2-fluoro-cellotrioside
PDB Compounds: (A:) Cellulose 1,4-beta-cellobiosidase

SCOPe Domain Sequences for d4c4da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c4da_ b.29.1.10 (A:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Trichoderma reesei, Cel7A [TaxId: 51453]}
esactlqsethppltwqkcssggtctqqtgsvvidanwrwthatnsstncydgntwsstl
cpdnetcaknccldgaayastygvttsgnslsidfvtqsaqknvgarlylmasdttyqef
tllgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdl
kfingqanvegwepssnnantgigghgsccsemdiwqansisealtphpcttvgqeiceg
dgcggtysdnryggtcdpdgcdwnpyrlgntsfygpgssftldttkkltvvtqfetsgai
nryyvqngvtfqqpnaelgsysgnelnddyctaeeaefggssfsdkggltqfkkatsggm
vlvmslwddyyanmlwldstyptnetsstpgavrgscstssgvpaqvesqspnakvtfsn
ikfgpigstgnpsg

SCOPe Domain Coordinates for d4c4da_:

Click to download the PDB-style file with coordinates for d4c4da_.
(The format of our PDB-style files is described here.)

Timeline for d4c4da_: