SCOPe 2.03: Domain d4c4da_: 4c4d A:

Lineage for d4c4da_ (4c4d A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
   contains many insertions in the common fold
   automatically mapped to Pfam PF00840

6. Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (6 species)

7. Species Trichoderma reesei, Cel7A [TaxId:51453] [68898] (13 PDB entries)

8. Domain d4c4da_: 4c4d A: [235859]
   automated match to d7cela_
   complexed with co, nag, peg; mutant

Details for d4c4da_

PDB Entry: 4c4d, 1.32 Å

PDB Description: covalent glycosyl-enzyme intermediate of hypocrea jecorina cel7a e217q mutant trapped using dnp-2-deoxy-2-fluoro-cellotrioside

PDB Compounds: (A:) Cellulose 1,4-beta-cellobiosidase

SCOPe Domain Sequences for d4c4da_:

Sequence; same for both SEQRES and ATOM records:

>d4c4da_ b.29.1.10 (A:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Trichoderma reesei, Cel7A [TaxId: 51453]}
esactlqsethppltwqkcssggtctqqtgsvvidanwrwthatnsstncydgntwsstl
cpdnetcaknccldgaayastygvttsgnslsidfvtqsaqknvgarlylmasdttyqef
tllgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdl
kfingqanvegwepssnnantgigghgsccsemdiwqansisealtphpcttvgqeiceg
dgcggtysdnryggtcdpdgcdwnpyrlgntsfygpgssftldttkkltvvtqfetsgai
nryyvqngvtfqqpnaelgsysgnelnddyctaeeaefggssfsdkggltqfkkatsggm
vlvmslwddyyanmlwldstyptnetsstpgavrgscstssgvpaqvesqspnakvtfsn
ikfgpigstgnpsg

Timeline for d4c4da_:

• d4c4da_ is new in SCOPe 2.03-stable
  
• d4c4da_ appears in SCOPe 2.04
  
• d4c4da_ appears in the current release, SCOPe 2.08