SCOPe 2.08: Domain d4c21b2: 4c21 B:354-588

Lineage for d4c21b2 (4c21 B:354-588)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.2: FucI/AraA C-terminal domain-like [50443] (3 families)

5. Family b.43.2.0: automated matches [227252] (1 protein)
   not a true family

6. Protein automated matches [227032] (5 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:170187] [229525] (3 PDB entries)

8. Domain d4c21b2: 4c21 B:354-588 [235858]
   Other proteins in same PDB: d4c21a1, d4c21b1, d4c21b3
   automated match to d4c21a2
   complexed with edo, foc, mn

Details for d4c21b2

PDB Entry: 4c21, 2.55 Å

PDB Description: L-Fucose Isomerase In Complex With Fucitol

PDB Compounds: (B:) l-fucose isomerase

SCOPe Domain Sequences for d4c21b2:

Sequence; same for both SEQRES and ATOM records:

>d4c21b2 b.43.2.0 (B:354-588) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
pqifadvrtywspeavkrvtghtlegraaagflhlinsgsctldgtgqatrdgkpimkpf
weleesevqamlentdfppanreyfrgggfstrfltkgdmpvtmvrlnllkgvgpvlqia
egytlelpedvhhtldnrtdpgwpttwfaprltgkgafksvydvmnnwganhgaityghi
gadlitlasmlripvnmhnvpeedifrpknwslfgtedlesadyracqllgplhk

Timeline for d4c21b2:

• d4c21b2 first appeared in SCOPe 2.03
  
• d4c21b2 appears in SCOPe 2.07