Class b: All beta proteins [48724] (180 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.2: FucI/AraA C-terminal domain-like [50443] (3 families) |
Family b.43.2.0: automated matches [227252] (1 protein) not a true family |
Protein automated matches [227032] (5 species) not a true protein |
Species Streptococcus pneumoniae [TaxId:170187] [229525] (3 PDB entries) |
Domain d4c21b2: 4c21 B:354-588 [235858] Other proteins in same PDB: d4c21a1, d4c21b1, d4c21b3 automated match to d4c21a2 complexed with edo, foc, mn |
PDB Entry: 4c21 (more details), 2.55 Å
SCOPe Domain Sequences for d4c21b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c21b2 b.43.2.0 (B:354-588) automated matches {Streptococcus pneumoniae [TaxId: 170187]} pqifadvrtywspeavkrvtghtlegraaagflhlinsgsctldgtgqatrdgkpimkpf weleesevqamlentdfppanreyfrgggfstrfltkgdmpvtmvrlnllkgvgpvlqia egytlelpedvhhtldnrtdpgwpttwfaprltgkgafksvydvmnnwganhgaityghi gadlitlasmlripvnmhnvpeedifrpknwslfgtedlesadyracqllgplhk
Timeline for d4c21b2: