SCOPe 2.06: Domain d4c2aa_: 4c2a A:

Lineage for d4c2aa_ (4c2a A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (6 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)

6. Protein automated matches [190060] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186779] (13 PDB entries)

8. Domain d4c2aa_: 4c2a A: [235851]
   Other proteins in same PDB: d4c2ab_
   automated match to d1ijba_
   complexed with act, ca, cac, peg; mutant

Details for d4c2aa_

PDB Entry: 4c2a, 2.08 Å

PDB Description: crystal structure of high-affinity von willebrand factor a1 domain with r1306q and i1309v mutations in complex with high affinity gpib alpha

PDB Compounds: (A:) von willebrand factor

SCOPe Domain Sequences for d4c2aa_:

Sequence; same for both SEQRES and ATOM records:

>d4c2aa_ c.62.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
plhdfycsrlldlvflldgssrlseaefevlkafvvdmmeqlrvsqkwvrvavveyhdgs
hayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialllm
asqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvde
leqqrdeivsylcdlapeappp

Timeline for d4c2aa_:

• d4c2aa_ first appeared in SCOPe 2.03
  
• d4c2aa_ appears in SCOPe 2.05
  
• d4c2aa_ appears in SCOPe 2.07
  
• d4c2aa_ appears in the current release, SCOPe 2.08