![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
![]() | Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
![]() | Protein automated matches [226935] (30 species) not a true protein |
![]() | Species Brucella suis [TaxId:204722] [230320] (1 PDB entry) |
![]() | Domain d4o5ma2: 4o5m A:239-381 [235844] Other proteins in same PDB: d4o5ma1, d4o5ma3, d4o5mb1, d4o5mb3, d4o5mc1, d4o5mc3, d4o5md1, d4o5md3 automated match to d4o5md2 complexed with ca, pg5 |
PDB Entry: 4o5m (more details), 2.2 Å
SCOPe Domain Sequences for d4o5ma2:
Sequence, based on SEQRES records: (download)
>d4o5ma2 a.29.3.0 (A:239-381) automated matches {Brucella suis [TaxId: 204722]} ldyervvlaggplgimaacldvvvpyvherkqfdqpigefqlmqckladmyvtfnasray vyavaaacdrgettrkdaagcilysaenatqmalqaiqslggngyindyptgrllrdakl yeigagtseirrmligrelfqet
>d4o5ma2 a.29.3.0 (A:239-381) automated matches {Brucella suis [TaxId: 204722]} ldyervvlaggplgimaacldvvvpyvherkqfdqpgefqlmqckladmyvtfnasrayv yavaaacdrgettrkdaagcilysaenatqmalqaiqslggngyindyptgrllrdakly eigagirrmligrelfqet
Timeline for d4o5ma2: