Lineage for d4o5ma1 (4o5m A:1-226)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2246106Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 2246107Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 2246252Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 2246253Protein automated matches [226934] (25 species)
    not a true protein
  7. 2246285Species Brucella suis [TaxId:204722] [230318] (1 PDB entry)
  8. 2246286Domain d4o5ma1: 4o5m A:1-226 [235843]
    Other proteins in same PDB: d4o5ma2, d4o5ma3, d4o5mb2, d4o5mb3, d4o5mc2, d4o5mc3, d4o5md2, d4o5md3
    automated match to d4o5md1
    complexed with ca, pg5

Details for d4o5ma1

PDB Entry: 4o5m (more details), 2.2 Å

PDB Description: X-ray Crystal Structure of Isovaleryl-CoA Dehydrogenase from Brucella suis
PDB Compounds: (A:) isovaleryl-coa dehydrogenase

SCOPe Domain Sequences for d4o5ma1:

Sequence, based on SEQRES records: (download)

>d4o5ma1 e.6.1.0 (A:1-226) automated matches {Brucella suis [TaxId: 204722]}
mnfglgeeiealrdtvrrfaesriaplaaetdrnnqfpmhlwrefgelgvlgitapedyg
gagmgylahciameeisrasasiglsygahsnlcvnqitrngspeqrakylpklisgehv
galamsepgagsdvvsmklaaekrgdryvlngnkmwitngpdadvlvvyaktdlsagprg
isafiiekgfkgfstaqkldklgmrgsntcelvfedcevpaenllg

Sequence, based on observed residues (ATOM records): (download)

>d4o5ma1 e.6.1.0 (A:1-226) automated matches {Brucella suis [TaxId: 204722]}
mnfglgeeiealrdtvrrfaesriaplaaetdrnnqfpmhlwrefgelgvlgitapedyg
gagmgylahciameeisrasasiglsygahsnlcvnqitrngspeqrakylpklisgehv
galamklaaekrgdryvlngnkmwitngpdadvlvvyaktgisafiiekgfkgfstaqkl
dklgmrgsntcelvfedcevpaenllg

SCOPe Domain Coordinates for d4o5ma1:

Click to download the PDB-style file with coordinates for d4o5ma1.
(The format of our PDB-style files is described here.)

Timeline for d4o5ma1: