Lineage for d4o0nd1 (4o0n D:3-155)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951071Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2951327Protein automated matches [190032] (18 species)
    not a true protein
  7. 2951586Species Toxoplasma gondii [TaxId:508771] [230191] (2 PDB entries)
  8. 2951602Domain d4o0nd1: 4o0n D:3-155 [235834]
    Other proteins in same PDB: d4o0nb2, d4o0nd2, d4o0ne2, d4o0nf2
    automated match to d4o0na_
    complexed with so4

Details for d4o0nd1

PDB Entry: 4o0n (more details), 2.4 Å

PDB Description: 2.4 angstrom resolution crystal structure of putative nucleoside diphosphate kinase from toxoplasma gondii.
PDB Compounds: (D:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d4o0nd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o0nd1 d.58.6.1 (D:3-155) automated matches {Toxoplasma gondii [TaxId: 508771]}
akqqertyimvkpdgvqrglvsevirrfeqrgyklvalkmkspdatlleehyadlkgkpf
fpglisymtsgpvvcmvwegtdvvkqgrrmlgetrplesnpgtlrgdfcidvgrnivhgs
dsvesankeislwftpeeicewtsaqhkwvyeq

SCOPe Domain Coordinates for d4o0nd1:

Click to download the PDB-style file with coordinates for d4o0nd1.
(The format of our PDB-style files is described here.)

Timeline for d4o0nd1: