Lineage for d4nvtd_ (4nvt D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2078561Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2078925Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 2078926Protein automated matches [190605] (21 species)
    not a true protein
  7. 2078930Species Brucella melitensis [TaxId:546272] [229966] (1 PDB entry)
  8. 2078934Domain d4nvtd_: 4nvt D: [235831]
    automated match to d4nvta_

Details for d4nvtd_

PDB Entry: 4nvt (more details), 2.1 Å

PDB Description: Crystal Structure of Triosephosphate Isomerase from Brucella melitensis
PDB Compounds: (D:) triosephosphate isomerase

SCOPe Domain Sequences for d4nvtd_:

Sequence, based on SEQRES records: (download)

>d4nvtd_ c.1.1.0 (D:) automated matches {Brucella melitensis [TaxId: 546272]}
irplvagnwkmngkgesltelraiaaglssdlgrkldavicvpatllsraaetlegetvg
lggqdahfktsgahtgdispemlkeagathvilghserrtdhhesnklicakteaawaag
lvaivcvgetaserkaeraldvigdqlsgslpdgvtaentiiayepvwaigtgltptvqd
vraahafmreqlierfgakgahlrllyggsvkpsnaaellgvadvdgalvggaslkaadf
laicetyrn

Sequence, based on observed residues (ATOM records): (download)

>d4nvtd_ c.1.1.0 (D:) automated matches {Brucella melitensis [TaxId: 546272]}
irplvagnwkmngkgesltelraiaaglssdlgrkldavicvpatllsraaetlegetvg
lggqdahfktsgahtgdispemlkeagathvilghserrtdhhesnklicakteaawaag
lvaivcvgetaserkaeraldvigdqlsgslpdgvtaentiiayepvwailtptvqdvra
ahafmreqlierfgakgahlrllyggsvkpsnaaellgvadvdgalvggaslkaadflai
cetyrn

SCOPe Domain Coordinates for d4nvtd_:

Click to download the PDB-style file with coordinates for d4nvtd_.
(The format of our PDB-style files is described here.)

Timeline for d4nvtd_: