SCOPe 2.03: Domain d4npya1: 4npy A:1-106A

Lineage for d4npya1 (4npy A:1-106A)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)

8. Domain d4npya1: 4npy A:1-106A [235828]
   automated match to d4npyl1
   complexed with gol

Details for d4npya1

PDB Entry: 4npy, 1.8 Å

PDB Description: crystal structure of germline fab pgt121, a putative precursor of the broadly reactive and potent hiv-1 neutralizing antibody

PDB Compounds: (A:) germline PGT121 light chain

SCOPe Domain Sequences for d4npya1:

Sequence; same for both SEQRES and ATOM records:

>d4npya1 b.1.1.0 (A:1-106A) automated matches {Human (Homo sapiens) [TaxId: 9606]}
syvltqppsvsvapgqtaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiper
fsgsnsgntatltisrveagdeadyycqvwdsrgptnwvfgggtkltvl

Timeline for d4npya1:

• d4npya1 is new in SCOPe 2.03-stable
  
• d4npya1 appears in SCOPe 2.04
  
• d4npya1 appears in the current release, SCOPe 2.08