SCOPe 2.06: Domain d4nu7c_: 4nu7 C:

Lineage for d4nu7c_ (4nu7 C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.0: automated matches [191350] (1 protein)
   not a true family

6. Protein automated matches [190292] (34 species)
   not a true protein

7. Species Toxoplasma gondii [TaxId:5811] [229953] (1 PDB entry)

8. Domain d4nu7c_: 4nu7 C: [235825]
   automated match to d4nu7b_
   complexed with cl, so4, zn

Details for d4nu7c_

PDB Entry: 4nu7, 2.05 Å

PDB Description: 2.05 angstrom crystal structure of ribulose-phosphate 3-epimerase from toxoplasma gondii.

PDB Compounds: (C:) ribulose-phosphate 3-epimerase

SCOPe Domain Sequences for d4nu7c_:

Sequence; same for both SEQRES and ATOM records:

>d4nu7c_ c.1.2.0 (C:) automated matches {Toxoplasma gondii [TaxId: 5811]}
qlkpiicpsvlasdlsslasdakrmvdagcdwlhldimdghfvpnisfgpgvvkalrghl
ksaffdvhlmvsepekwiqpfadagansitfhwesvggdlqraaelakriqargikagla
ikpatkfedlgealagdnfdmllvmtvepgfggqkfmadmlqkvrtarslfpklniqvdg
gldgetvkpaasaganvivagtsmfkaenpaalmtfmrdviaasdtl

Timeline for d4nu7c_:

• d4nu7c_ first appeared in SCOPe 2.03
  
• d4nu7c_ appears in SCOPe 2.05
  
• d4nu7c_ appears in SCOPe 2.07
  
• d4nu7c_ appears in the current release, SCOPe 2.08