SCOPe 2.08: Domain d4npcb_: 4npc B:

Lineage for d4npcb_ (4npc B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Brucella suis [TaxId:470137] [229017] (4 PDB entries)

8. Domain d4npcb_: 4npc B: [235818]
   automated match to d4npca_
   complexed with act

Details for d4npcb_

PDB Entry: 4npc, 1.75 Å

PDB Description: crystal structure of an oxidoreductase, short-chain dehydrogenase/reductase family protein from brucella suis

PDB Compounds: (B:) sorbitol dehydrogenase

SCOPe Domain Sequences for d4npcb_:

Sequence; same for both SEQRES and ATOM records:

>d4npcb_ c.2.1.0 (B:) automated matches {Brucella suis [TaxId: 470137]}
apqidlnfplsekvaivtggasgigaaiskafiakgakvavldisadiakakaeelgena
kpfvcdvssqqsvndaitavisqfgkidiavnsagvvylapaedisldywdktininlkg
sflvtqavgramiaagnggkiinlasqagtvaieehvaycaskfgvigmsktfaaewgky
gicvntlsptivltelgkkawagekgeaakkripagrfaypeeiaaaavflasagadmit
gadllidggytil

Timeline for d4npcb_:

• d4npcb_ first appeared in SCOPe 2.03
  
• d4npcb_ appears in SCOPe 2.07