Lineage for d4npba2 (4npb A:82-235)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877401Family c.47.1.9: DsbC/DsbG C-terminal domain-like [52898] (3 proteins)
    elaborated common fold
  6. 2877427Protein automated matches [228323] (3 species)
    not a true protein
  7. 2877438Species Yersinia pestis [TaxId:214092] [230169] (1 PDB entry)
  8. 2877439Domain d4npba2: 4npb A:82-235 [235817]
    Other proteins in same PDB: d4npba1, d4npba3, d4npbb1, d4npbb3
    automated match to d4npbb2
    complexed with po4

Details for d4npba2

PDB Entry: 4npb (more details), 2.15 Å

PDB Description: the crystal structure of thiol:disulfide interchange protein dsbc from yersinia pestis co92
PDB Compounds: (A:) Protein disulfide isomerase II

SCOPe Domain Sequences for d4npba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4npba2 c.47.1.9 (A:82-235) automated matches {Yersinia pestis [TaxId: 214092]}
nvtnqallkklealssemivykapeekhvitvftditcgycrklheqmkdynalgitvry
lafprqglssqaekdmrsiwcmadrnkafddamknndispatcktdiskhyqlgvqfgiq
gtpaivlqngtivpgyqgpkemlqmlnahqaslk

SCOPe Domain Coordinates for d4npba2:

Click to download the PDB-style file with coordinates for d4npba2.
(The format of our PDB-style files is described here.)

Timeline for d4npba2: