SCOPe 2.03: Domain d4npba1: 4npb A:21-81

Lineage for d4npba1 (4npb A:21-81)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.3: DsbC/DsbG N-terminal domain-like [54423] (2 families)

5. Family d.17.3.0: automated matches [228319] (1 protein)
   not a true family

6. Protein automated matches [228320] (2 species)
   not a true protein

7. Species Yersinia pestis [TaxId:214092] [230167] (1 PDB entry)

8. Domain d4npba1: 4npb A:21-81 [235816]
   Other proteins in same PDB: d4npba2, d4npbb2
   automated match to d4npbb1
   complexed with po4, suc

Details for d4npba1

PDB Entry: 4npb, 2.15 Å

PDB Description: the crystal structure of thiol:disulfide interchange protein dsbc from yersinia pestis co92

PDB Compounds: (A:) Protein disulfide isomerase II

SCOPe Domain Sequences for d4npba1:

Sequence; same for both SEQRES and ATOM records:

>d4npba1 d.17.3.0 (A:21-81) automated matches {Yersinia pestis [TaxId: 214092]}
addsaiqqtlkkldiqqadiqpspipgistvmtesgvlyisadgkhllqgplydvsgdqp
i

Timeline for d4npba1:

• d4npba1 is new in SCOPe 2.03-stable
  
• d4npba1 appears in SCOPe 2.04
  
• d4npba1 appears in the current release, SCOPe 2.08