Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.3: DsbC/DsbG N-terminal domain-like [54423] (2 families) |
Family d.17.3.0: automated matches [228319] (1 protein) not a true family |
Protein automated matches [228320] (2 species) not a true protein |
Species Yersinia pestis [TaxId:214092] [230167] (1 PDB entry) |
Domain d4npba1: 4npb A:21-81 [235816] Other proteins in same PDB: d4npba2, d4npbb2 automated match to d4npbb1 complexed with po4, suc |
PDB Entry: 4npb (more details), 2.15 Å
SCOPe Domain Sequences for d4npba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4npba1 d.17.3.0 (A:21-81) automated matches {Yersinia pestis [TaxId: 214092]} addsaiqqtlkkldiqqadiqpspipgistvmtesgvlyisadgkhllqgplydvsgdqp i
Timeline for d4npba1: