Lineage for d4nmuc1 (4nmu C:1-144)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133854Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2133855Protein automated matches [190056] (165 species)
    not a true protein
  7. 2133907Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [194451] (2 PDB entries)
  8. 2133911Domain d4nmuc1: 4nmu C:1-144 [235812]
    Other proteins in same PDB: d4nmua2, d4nmuc2
    automated match to d4nmua_
    complexed with acy, edo, gol, mg, peg

Details for d4nmuc1

PDB Entry: 4nmu (more details), 1.35 Å

PDB Description: Crystal Structure of Thiol-disulfide Oxidoreductase from Bacillus str. 'Ames Ancestor'
PDB Compounds: (C:) Thiol-disulfide oxidoreductase resA

SCOPe Domain Sequences for d4nmuc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nmuc1 c.47.1.0 (C:1-144) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
adkekmqigkeapnfvvtdlegkkielkdlkgkgvflnfwgtwckpcekempymnelypk
ykekgveiialdadetdiavknfvnqyglkfpvaidkgqkiigtygvgplptsflidkdg
kvveqiigeqtkeqlegylkkitp

SCOPe Domain Coordinates for d4nmuc1:

Click to download the PDB-style file with coordinates for d4nmuc1.
(The format of our PDB-style files is described here.)

Timeline for d4nmuc1: