SCOPe 2.08: Domain d4nmuc1: 4nmu C:1-144

Lineage for d4nmuc1 (4nmu C:1-144)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [194451] (2 PDB entries)

8. Domain d4nmuc1: 4nmu C:1-144 [235812]
   Other proteins in same PDB: d4nmua2, d4nmuc2
   automated match to d4nmua_
   complexed with acy, edo, gol, mg, peg

Details for d4nmuc1

PDB Entry: 4nmu, 1.35 Å

PDB Description: Crystal Structure of Thiol-disulfide Oxidoreductase from Bacillus str. 'Ames Ancestor'

PDB Compounds: (C:) Thiol-disulfide oxidoreductase resA

SCOPe Domain Sequences for d4nmuc1:

Sequence; same for both SEQRES and ATOM records:

>d4nmuc1 c.47.1.0 (C:1-144) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
adkekmqigkeapnfvvtdlegkkielkdlkgkgvflnfwgtwckpcekempymnelypk
ykekgveiialdadetdiavknfvnqyglkfpvaidkgqkiigtygvgplptsflidkdg
kvveqiigeqtkeqlegylkkitp

Timeline for d4nmuc1:

• d4nmuc1 first appeared in SCOPe 2.03, called d4nmuc_
  
• d4nmuc1 appears in SCOPe 2.07