Lineage for d4nhzm2 (4nhz M:104-234)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1270513Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1270514Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1271284Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1271285Protein automated matches [226831] (36 species)
    not a true protein
  7. 1271318Species Bradyrhizobium sp. [TaxId:288000] [227813] (2 PDB entries)
  8. 1271332Domain d4nhzm2: 4nhz M:104-234 [235798]
    Other proteins in same PDB: d4nhza1, d4nhzb1, d4nhzc1, d4nhzd1, d4nhze1, d4nhzf1, d4nhzg1, d4nhzh1, d4nhzi1, d4nhzj1, d4nhzk1, d4nhzl1, d4nhzm1, d4nhzn1, d4nhzo1, d4nhzp1
    automated match to d4mf7a2
    complexed with gsh

Details for d4nhzm2

PDB Entry: 4nhz (more details), 1.9 Å

PDB Description: crystal structure of glutathione transferase bbta-3750 from bradyrhizobium sp., target efi-507290, with one glutathione bound
PDB Compounds: (M:) Putative glutathione S-transferase enzyme with thioredoxin-like domain

SCOPe Domain Sequences for d4nhzm2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nhzm2 a.45.1.0 (M:104-234) automated matches {Bradyrhizobium sp. [TaxId: 288000]}
flpadparrwqtlqwlhfqmggigpmfgqlgffhkfagreyedkrplqryvaeskrllgv
learldgrqwimdadytiadiatlgwvrnligfygarelvafdelthvpawlerglarpa
vqrgleipkrp

SCOPe Domain Coordinates for d4nhzm2:

Click to download the PDB-style file with coordinates for d4nhzm2.
(The format of our PDB-style files is described here.)

Timeline for d4nhzm2: