SCOPe 2.08: Domain d4nhzk2: 4nhz K:104-234

Lineage for d4nhzk2 (4nhz K:104-234)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Bradyrhizobium sp. [TaxId:288000] [227813] (2 PDB entries)

8. Domain d4nhzk2: 4nhz K:104-234 [235794]
   Other proteins in same PDB: d4nhza1, d4nhzb1, d4nhzb3, d4nhzc1, d4nhzd1, d4nhze1, d4nhzf1, d4nhzg1, d4nhzh1, d4nhzh3, d4nhzi1, d4nhzj1, d4nhzk1, d4nhzl1, d4nhzm1, d4nhzn1, d4nhzo1, d4nhzp1
   automated match to d4mf7a2
   complexed with gsh

Details for d4nhzk2

PDB Entry: 4nhz, 1.9 Å

PDB Description: crystal structure of glutathione transferase bbta-3750 from bradyrhizobium sp., target efi-507290, with one glutathione bound

PDB Compounds: (K:) Putative glutathione S-transferase enzyme with thioredoxin-like domain

SCOPe Domain Sequences for d4nhzk2:

Sequence; same for both SEQRES and ATOM records:

>d4nhzk2 a.45.1.0 (K:104-234) automated matches {Bradyrhizobium sp. [TaxId: 288000]}
flpadparrwqtlqwlhfqmggigpmfgqlgffhkfagreyedkrplqryvaeskrllgv
learldgrqwimdadytiadiatlgwvrnligfygarelvafdelthvpawlerglarpa
vqrgleipkrp

Timeline for d4nhzk2:

• d4nhzk2 first appeared in SCOPe 2.03
  
• d4nhzk2 appears in SCOPe 2.07