Lineage for d4nhzk2 (4nhz K:104-234)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2713864Species Bradyrhizobium sp. [TaxId:288000] [227813] (2 PDB entries)
  8. 2713876Domain d4nhzk2: 4nhz K:104-234 [235794]
    Other proteins in same PDB: d4nhza1, d4nhzb1, d4nhzb3, d4nhzc1, d4nhzd1, d4nhze1, d4nhzf1, d4nhzg1, d4nhzh1, d4nhzh3, d4nhzi1, d4nhzj1, d4nhzk1, d4nhzl1, d4nhzm1, d4nhzn1, d4nhzo1, d4nhzp1
    automated match to d4mf7a2
    complexed with gsh

Details for d4nhzk2

PDB Entry: 4nhz (more details), 1.9 Å

PDB Description: crystal structure of glutathione transferase bbta-3750 from bradyrhizobium sp., target efi-507290, with one glutathione bound
PDB Compounds: (K:) Putative glutathione S-transferase enzyme with thioredoxin-like domain

SCOPe Domain Sequences for d4nhzk2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nhzk2 a.45.1.0 (K:104-234) automated matches {Bradyrhizobium sp. [TaxId: 288000]}
flpadparrwqtlqwlhfqmggigpmfgqlgffhkfagreyedkrplqryvaeskrllgv
learldgrqwimdadytiadiatlgwvrnligfygarelvafdelthvpawlerglarpa
vqrgleipkrp

SCOPe Domain Coordinates for d4nhzk2:

Click to download the PDB-style file with coordinates for d4nhzk2.
(The format of our PDB-style files is described here.)

Timeline for d4nhzk2: